Please wait a bit while StatShow is computing website's data...

Domain Ownership Lookup arrow rahmi domains

Results of domain names owned by "rahmi" (Person or Organization)

 Page 8 of 98 results

#3,704,728 (-29%) - cheapairimpactwrench.ideaidee.com
Owner: rahmi junita
Title: Cheap Air Impact Wrench|Cheap Air Impact Wrench Reviews|Cheap Air Impact Wrench Price
Description: Find air impact wrenches available at deep discounts.
Keywords:cheap air impact wrench, cheap air impact wrench reviews, cheap air impact wrench price
#3,704,728 (-29%) - cheapairimpactoolreviews.ideaidee.com
Owner: rahmi junita
Title: Cheap Air Impactool Reviews|Cheap Air Impactool Reviews Sale|Cheap Air Impactool Reviews Price
Description: Buy cheap air impactool at this site.
Keywords:cheap air impactool reviews, cheap air impactool reviews sale, cheap air impactool reviews price
#3,704,728 (-29%) - 18gaugebradnailerreviews.ideaidee.com
Owner: rahmi junita
Title: 18 Gauge Brad Nailer Reviews|18 Gauge Brad Nailer Reviews Sale|18 Gauge Brad Nailer Reviews Price
Description: Find great deals on this site for 18 Gauge Brad Nailer.
Keywords:18 gauge brad nailer reviews, 18 gauge brad nailer reviews sale, 18 gauge brad nailer reviews price
#5,274,310 (-57%) - 6gallonpancakeaircompressorreviews.ideaidee.com
Owner: rahmi junita
Title: 6 Gallon Pancake Air Compressor Reviews|6 Gallon Pancake Air Compressor Reviews Sale|6 Gallon Pancake Air Compressor Reviews Pr
Description: Find and compare Pancake air compressors side by side at this site.
Keywords:6 gallon pancake air compressor reviews, 6 gallon pancake air compressor reviews sale, 6 gallon pancake air compressor reviews price
#5,274,310 (-57%) - cheapuniversalhandshowercomponentsreviews.ideaidee.com
Owner: rahmi junita
Title: Cheap Universal Hand Shower Components Reviews|Cheap Universal Hand Shower Components Reviews Sale|Cheap Universal Hand Shower
Description: Are you looking for cheap price of Universal Hand Showering Components, find here!
Keywords:cheap universal hand shower components reviews, cheap universal hand shower components reviews , cheap universal hand shower components reviews
#7,795,557 (-71%) - cheapframingstripnailerreviews.ideaidee.com
Owner: rahmi junita
Title: Cheap Framing Strip Nailer Reviews|Cheap Framing Strip Nailer Reviews Sale|Cheap Framing Strip Nailer Reviews Price
Description: Shop for your next framing nailer at this site.
Keywords:cheap framing strip nailer reviews, cheap framing strip nailer reviews sale, cheap framing strip nailer reviews price
#7,795,557 (-71%) - cheappinnailer.ideaidee.com
Owner: rahmi junita
Title: Cheap Pin Nailer|Cheap Pin Nailer Reviews|Cheap Pin Nailer Price
Description: Shop online for pin nailer at this site.
Keywords:cheap pin nailer, cheap pin nailer reviews, cheap pin nailer price
#7,795,557 (-71%) - angledfinishnailerreviews.ideaidee.com
Owner: rahmi junita
Title: Angled Finish Nailer Reviews|Angled Finish Nailer Reviews Sale|Angled Finish Nailer Reviews Price
Description: Find Angled Finish Nailer at this site for lower prices.
Keywords:angled finish nailer reviews, angled finish nailer reviews sale, angled finish nailer reviews price
#7,795,557 (-71%) - bestaircompressorstarterkitreviews.ideaidee.com
Owner: rahmi junita
Title: Best Air Compressor Starter Kit Reviews|Best Air Compressor Starter Kit Reviews Sale|Best Air Compressor Starter Kit Reviews Pr
Description: Find great deals on best air compressors starter kits at this site.
Keywords:best air compressor starter kit reviews, best air compressor starter kit reviews sale, best air compressor starter kit reviews price
#7,858,028 (-71%) - cheap3gallontankcompressorreviews.ideaidee.com
Owner: rahmi junita
Title: Cheap 3 Gallon Tank Compressor Reviews|Cheap 3 Gallon Tank Compressor Reviews Sale|Cheap 3 Gallon Tank Compressor Reviews Price
Description: Find Quality Products from this site for 3 Gallon Tank Compressor.
Keywords:cheap 3 gallon tank compressor reviews, cheap 3 gallon tank compressor reviews sale, cheap 3 gallon tank compressor reviews price
< Previous  3 4 5 6 7 8 9 10  Next >